PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0000900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 1001aa    MW: 112333 Da    PI: 4.9414
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0000900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-13853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
   Spipo1G0000900  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.7e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
   Spipo1G0000900  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139215.2E-131070No hitNo description
CDDcd001671.00E-111053No hitNo description
SuperFamilySSF466893.95E-2133109IPR009057Homeodomain-like
CDDcd116594.14E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.7E-1457104IPR009057Homeodomain-like
SMARTSM007175.5E-1358105IPR001005SANT/Myb domain
PROSITE profilePS5129415.94258107IPR017930Myb domain
PfamPF118311.6E-50407653IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1001 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDMACAKD ENYEPSDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDNRHR KRKRKGIDYN AEIPFEKRPP SGFYDASGEE RPPEQPKFPT  240
TIEELEGKRR IDVEAQLRKQ DIAKNKIVQR QDAPSAILQI NKLNDPEAVR KRAKLMLPAP  300
QISDQELEEI AKMGYAGDLV SGTDDQGEGS SATRALLANY SQTPRQGMTP FQTPQRAPAG  360
KADAIMMEAE NLARWRESQT PLLGGENPEL HPSDFSGVTP RKREIQTPNP LVTPLASPGP  420
MALTPRIGST PSRDGYSYGA TPRGTPIRDE LRINKEMDDV KLELRRQAEM RKMLQSGLTG  480
LPQPKDEYQI KPTPIELEED EVKIEEDMSD KMARERAEEQ ARQDALLKKR SKVLQRELPR  540
PPAASLDIIR NSFIRGDEDK SSFVPPTLFE QADEMINKEL LALLEHDNSK YPLDEKAEKG  600
KKKGTRRAAN GKSTPSIPDI EDFDESHLQE ADWLIKEEVR FLRVAMGHED ESFDDFVKAR  660
DACQEDLMYF PVRSTYGLAS VAGNSEKLAA LQNEFENVKK RMDEEAKKAT KIEQKIKVLT  720
HGYQTRSGRL CSQIEATFKQ LDTAGTELEC FQSLQKQEQL AAAYRVNGLV EEVNRQMELE  780
RKLQRRYSDL LTEHERTQKL LEEHRIRLQM EEEIEARNRA LEEEIAAKNR ALEEETAGEK  840
QIREEEMPVE DRASDILKGE EGPDISASGE VVHVVASSEE QEAVVKEEVK PEHGEVGDGW  900
PGSGAEKGQN SEAEISAGDQ GQTAPLSSLE ESAGPVPDSE REGGPFGPEE TMDMDDGVSP  960
AAAVEAHQQG SGGAKPADLV DDDRAGGVEE GVGSVSGAGS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDNRHRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010914614.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLM0U2U30.0M0U2U3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P23340_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5